PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H01192.1.p
Common NameEUGRSUZ_H01192
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HB-other
Protein Properties Length: 182aa    MW: 20163.4 Da    PI: 10.5241
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H01192.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.24.8e-0769125157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +r+R  ++++ ++ ++++F  +  +s++e +e+++  g+t +qV+ +F  +R + +k
  Eucgr.H01192.1.p  69 KRPRDLLNPKAVKYMQSVFSIKDAISKKESREISALFGVTVTQVRDFFNSQRSRVRK 125
                       799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.73466126IPR001356Homeobox domain
SMARTSM003890.002768130IPR001356Homeobox domain
SuperFamilySSF466893.98E-768128IPR009057Homeodomain-like
CDDcd000864.44E-569125No hitNo description
Gene3DG3DSA:1.10.10.601.5E-669130IPR009057Homeodomain-like
PfamPF000461.6E-469125IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MEVLGEDLSE QEIGSSPESL RQLLESQHAL FRGQIDRLQS IVVAQCRLTG VNPLAQEMAA  60
GALSIKIGKR PRDLLNPKAV KYMQSVFSIK DAISKKESRE ISALFGVTVT QVRDFFNSQR  120
SRVRKFVRLS REKAIRLKAP KDSNVFPPVN SESATSTPVD LLPLNSIAPR CWRCLTLPCA  180
K*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H01192.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4504694e-35AM450469.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X023104.10, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069972.11e-112PREDICTED: LOW QUALITY PROTEIN: homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-63LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A059AYM11e-130A0A059AYM1_EUCGR; Uncharacterized protein
STRINGVIT_07s0104g01580.t011e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.26e-65HB-other family protein